General Information

  • ID:  hor000097
  • Uniprot ID:  P01175
  • Protein name:  Neurophysin 1
  • Gene name:  OXT
  • Organism:  Bos taurus (Bovine)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031855 oxytocin receptor binding; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0043627 response to estrogen; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0030141 secretory granule

Sequence Information

  • Sequence:  AVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHEDPACDPEAAFSQH
  • Length:  94
  • Propeptide:  MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHEDPACDPEAAFSQH
  • Signal peptide:  MAGSSLACCLLGLLALTSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Bind oxytocin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  OXTR
  • Target Unid:  P56449
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-54; 13-27; 21-44; 28-34; 61-73; 67-85; 74-79
  • Structure ID:  1l5d(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    1l5d.pdbhor000097_AF2.pdbhor000097_ESM.pdb

Physical Information

Mass: 1121282 Formula: C393H613N117O133S14
Absent amino acids: MW Common amino acids: CG
pI: 4.33 Basic residues: 8
Polar residues: 38 Hydrophobic residues: 23
Hydrophobicity: -16.17 Boman Index: -11997
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 52.02
Instability Index: 5240.96 Extinction Coefficient cystines: 2365
Absorbance 280nm: 25.43

Literature

  • PubMed ID:  670174
  • Title:  Complete Amino Acid Sequence of Bovine neurophysin-I. A Major Secretory Product of the Posterior Pituitary